HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44754

Names and origin
Entry : P44754 (reviewed)
Entry name : HSLR_HAEIN
Protein names : Heat shock protein 15 homolog (HSP15)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : hslR
ORF names : HI_0562
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cellular response to heat; ribosomal large subunit binding; single-stranded RNA binding
GO identifier : GO:0003677; GO:0034605; GO:0043023; GO:0003727
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; RNA-binding; Reference proteome
General annotation
Domains : S4 RNA-binding domain (1)
Sequence similarities : Belongs to HSP15 family
Reference
PubMed ID : 7542800
Protein sequence
Length : 143 residues
>P44754|HSLR_HAEIN Haemophilus influenzae Rd KW20
MAEKEVRLDKWLWAARFYKTRSIAKAMIESGKVHYNNQRAKVSKIVEVGAMLKLRQGNEE
KEIKIIALSDQRRGAPEAQLLYQETESSVKKREEIAWARKNNSLSMPHPDRRPNKKERRD
LLKFKHQDKFE