HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44748

Names and origin
Entry : P44748 (reviewed)
Entry name : PRIB_HAEIN
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : priB
ORF names : HI_0546
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2003-10-24
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : Complete proteome; DNA replication; DNA-binding; Primosome; Reference proteome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Reference
PubMed ID : 7542800;
Protein sequence
Length : 116 residues
>P44748|PRIB_HAEIN Haemophilus influenzae Rd KW20
MLKSNLKIDNSFSVMGVVSRLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQ
ISGNQLIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID