HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44746

Names and origin
Entry : P44746 (reviewed)
Entry name : Y527_HAEIN
Protein names : Uncharacterized ferredoxin-like protein HI_0527
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0527
History
Date of creation : 1996-10-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-10-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : 4 iron, 4 sulfur cluster binding; metal ion binding; oxidation-reduction process
GO identifier : GO:0051539; GO:0046872; GO:0055114
Keywords
Ligand & Biological process : 4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Reference proteome; Repeat; Transport
General annotation
Domains : 4Fe-4S ferredoxin-type domains (2)
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 94 residues
>P44746|Y527_HAEIN Haemophilus influenzae Rd KW20
MALLITSKCTNCDMCLPECPNEAISIGDEIYVIDPILCTECVGHYDTPTCQKVCPITNCI
KPDPEHQETEEQLWERFVMIHHSDKL