HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44734

Names and origin
Entry : P44734 (reviewed)
Entry name : RBSD_HAEIN
Protein names : D-ribose pyranase (EC 5.5.1.n1)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rbsD
ORF names : HI_0501
EC number : 5.5.1.n1
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : D-ribose catabolic process; cytoplasm; intramolecular lyase activity; monosaccharide binding
GO identifier : GO:0019303; GO:0005737; GO:0016872; GO:0048029
Keywords
Ligand & Biological process : Carbohydrate metabolism; Complete proteome; Cytoplasm; Isomerase; Reference proteome
General annotation
Pathway : Carbohydrate metabolism; D-ribose degradation; D-ribose 5-phosphate from beta-D-ribopyranose: step 1/2.
Sequence similarities : Belongs to RbsD / FucU family, RbsD subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 151 residues
>P44734|RBSD_HAEIN Haemophilus influenzae Rd KW20
MKKTALLNAQLSHCIATLGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTN
EMYVERVVIAEEIKEKNPEILTALLTQLQKLESHQGNQIQVEFVSHETFKKFTLESKAIV
RTGECSPYANVILYSGVPF