HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44713

Names and origin
Entry : P44713 (reviewed)
Entry name : SECG_HAEIN
Protein names : Protein-export membrane protein SecG
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : secG
ORF names : HI_0445
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; plasma membrane; protein secretion
GO identifier : GO:0015450; GO:0016021; GO:0005886; GO:0009306
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Reference proteome; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to SecG family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 120 residues
>P44713|SECG_HAEIN Haemophilus influenzae Rd KW20
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA
TAFFVIALVLGNMNSHKGNVQKGTFDDLSQAAEQVQQQAAPAKDNKNSDIPQ