HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44707

Names and origin
Entry : P44707 (reviewed)
Entry name : DSBB_HAEIN
Protein names : Disulfide bond formation protein B (Disulfide oxidoreductase)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : dsbB
ORF names : HI_0428
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron carrier activity; integral to membrane; plasma membrane; protein disulfide oxidoreductase activity
GO identifier : GO:0009055; GO:0016021; GO:0005886; GO:0015035
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Chaperone; Complete proteome; Disulfide bond; Electron transport; Membrane; Oxidoreductase; Redox-active center; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to DsbB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 189 residues
>P44707|DSBB_HAEIN Haemophilus influenzae Rd KW20
MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGTI
ALLQPRVFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN