HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44672

Names and origin
Entry : P44672 (reviewed)
Entry name : ISCA_HAEIN
Protein names : Iron-binding protein IscA (Iron-sulfur cluster assembly protein)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : iscA
ORF names : HI_0376
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier : GO:0005506; GO:0016226; GO:0051536; GO:0005198
Keywords
Ligand & Biological process : Complete proteome; Iron; Metal-binding; Reference proteome
General annotation
Sequence similarities : Belongs to HesB/IscA family
Reference
PubMed ID : 7542800
Protein sequence
Length : 115 residues
>P44672|ISCA_HAEIN Haemophilus influenzae Rd KW20
MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQYGV
NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV