HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44650

Names and origin
Entry : P44650 (reviewed)
Entry name : NAPF_HAEIN
Protein names : Ferredoxin-type protein NapF homolog
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : napF
ORF names : HI_0342
History
Date of creation : 1995-11-01
Date of modification : 2013-10-16
Date of sequence modification : 2001-04-27
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 4 iron, 4 sulfur cluster binding; electron carrier activity; iron ion binding; oxidation-reduction process
GO identifier : GO:0051539; GO:0009055; GO:0005506; GO:0055114
Keywords
Ligand & Biological process : 4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Reference proteome; Repeat; Transport
General annotation
Domains : 4Fe-4S ferredoxin-type domains (4)
Reference
PubMed ID : 7542800
Protein sequence
Length : 188 residues
>P44650|NAPF_HAEIN Haemophilus influenzae Rd KW20
MTVENLPRRQFLRGKFSTLSCLENNQKQNFVGIRPPWSVENSIFVARCTRCGDCLSVCET
NILVKGDAGFPEVRFDNGECTFCGKCVDACKQPIFYPRDQLPWSHKIDISVSCLTLHRIE
CRTCQDNCPANAIRFKLQMGGVAQPLVNFDACNGCGACVQGCPVNAITMNDLKQNE