HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44635

Names and origin
Entry : P44635 (reviewed)
Entry name : NUDB_HAEIN
Protein names : Dihydroneopterin triphosphate pyrophosphatase (EC 3.6.1.-) (dATP pyrophosphohydrolase)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : nudB
ORF names : ntpA
EC number : 3.6.1.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA repair; dATP pyrophosphohydrolase activity; folic acid biosynthetic process; metal ion binding
GO identifier : GO:0006281; GO:0008828; GO:0046656; GO:0046872
Keywords
Ligand & Biological process : Complete proteome; Folate biosynthesis; Hydrolase; Magnesium; Metal-binding; Reference proteome
General annotation
Domains : Nudix hydrolase domain (1)
Sequence similarities : Belongs to Nudix hydrolase family
Reference
PubMed ID : 7542800
Protein sequence
Length : 170 residues
>P44635|NUDB_HAEIN Haemophilus influenzae Rd KW20
MRSDLTAFLMMQYKNNQSVLVVIYTKDTNRVLMLQRQDDPDFWQSVTGTIESDETPKKTA
IRELWEEVRLDISENSTALFDCNESIEFEIFPHFRYKYAPNITHCKEHWFLCEVEKEFIP
VLSEHLDFCWVSAKKAVEMTKSQNNAEAIKKYLFNLRR