HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44618

Names and origin
Entry : P44618 (reviewed)
Entry name : METJ_HAEIN
Protein names : Met repressor (Met regulon regulatory protein MetJ)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : metJ
ORF names : HI_0294
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2004-01-16
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; methionine biosynthetic process; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0005737; GO:0009086; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Complete proteome; Cytoplasm; DNA-binding; Methionine biosynthesis; Reference proteome; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to MetJ family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 113 residues
>P44618|METJ_HAEIN Haemophilus influenzae Rd KW20
MANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQLKSLRHATNSELLCE
AFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMRELGVDPESWEY