HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44617

Names and origin
Entry : P44617 (reviewed)
Entry name : Y293_HAEIN
Protein names : Probable heavy metal-dependent transcriptional regulator HI_0293
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0293
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; copper ion binding; cytoplasm; nucleotide binding; positive regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0005507; GO:0005737; GO:0000166; GO:0045893; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Activator; Complete proteome; Cytoplasm; DNA-binding; Reference proteome; Transcription; Transcription regulation
General annotation
Domains : HTH merR-type DNA-binding domain (1)
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 140 residues
>P44617|Y293_HAEIN Haemophilus influenzae Rd KW20
MNISEAAKLVGLSTKQIRDYEKMGLIKPAVRSLSGYRNYGESDLERLHFIRHSRNVGFSL
HQIAQLLALQDNPKRSCREVKVLTAQHIATLNQQIEQLQKMVQKLQHWHDSCQGNDNPEC
LILNGLNG