HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44588

Names and origin
Entry : P44588 (reviewed)
Entry name : ARFA_HAEIN
Protein names : Alternative ribosome-rescue factor A
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : arfA
ORF names : HI_0235
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : regulation of translation
GO identifier : GO:0006417
Keywords
Ligand & Biological process : Complete proteome; Reference proteome; Translation regulation
General annotation
Sequence similarities : Belongs to Alternative ribosome-rescue factor A family
Reference
PubMed ID : 7542800
Protein sequence
Length : 77 residues
>P44588|ARFA_HAEIN Haemophilus influenzae Rd KW20
MRKKQKSAVENETVYLHTRGVIKDNAVMALLGDKLFRQRVEKKRKGKGSYQRKAKHPGKI
FEKPDYKFF