HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44561

Names and origin
Entry : P44561 (reviewed)
Entry name : FUR_HAEIN
Protein names : Ferric uptake regulation protein (Ferric uptake regulator)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : fur
ORF names : HI_0190
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; metal ion binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0005737; GO:0046872; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding; Iron; Metal-binding; Reference proteome; Repressor; Transcription; Transcription regulation; Zinc
General annotation
Sequence similarities : Belongs to Fur family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 9727086
Protein sequence
Length : 158 residues
>P44561|FUR_HAEIN Haemophilus influenzae Rd KW20
MSEGNIKLLKKVGLKITEPRLTILALMQNHKNEHFSAEDVYKIFLEQGCEIGLATVYRVL
NQFDEAHIVIRHNFEGNKSVFELAPTEHHDHIICEDCGKVFEFTDNIIEQRQREISEKYG
IKLKTHNVYLYGKCSDINHCDENNSK