HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44476

Names and origin
Entry : P44476 (reviewed)
Entry name : MRED_HAEIN
Protein names : Rod shape-determining protein MreD
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : mreD
ORF names : HI_0039
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; regulation of cell shape
GO identifier : GO:0016021; GO:0005886; GO:0008360
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Cell shape; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to MreD family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 174 residues
>P44476|MRED_HAEIN Haemophilus influenzae Rd KW20
MQTRFILQWFTILSFFVIAFVLELAPWPVGFQMLKPAWLVLVLLYWVLAIPNKVSIGWSF
LLGLTWDLILGSTLGVHALVLSTSMYIIAKNYLILRNLSLWFQSLLVVLFVFIIRLLIFL
VEFSLHTAFFHWQAILGAFASGLLWPWVFLLMRKIRRKVKLH