HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44471

Names and origin
Entry : P44471 (reviewed)
Entry name : IOJAP_HAEIN
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rsfS
ORF names : HI_0034
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; mature ribosome assembly; negative regulation of ribosome biogenesis; negative regulation of translation
GO identifier : GO:0005737; GO:0042256; GO:0090071; GO:0017148
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Reference proteome; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 110 residues
>P44471|IOJAP_HAEIN Haemophilus influenzae Rd KW20
MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQRDAREMYQLEKLWA