HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44461

Names and origin
Entry : P44461 (reviewed)
Entry name : CITD_HAEIN
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : citD
ORF names : HI_0024
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm
GO identifier : GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Phosphoprotein; Reference proteome
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 103 residues
>P44461|CITD_HAEIN Haemophilus influenzae Rd KW20
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKAAAMRATDEAINWEAVL