HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44437

Names and origin
Entry : P44437 (reviewed)
Entry name : HFQ_HAEIN
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : hfq
ORF names : HI_0411
History
Date of creation : 1995-11-01
Date of modification : 2013-12-11
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003723; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Reference proteome; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Reference
PubMed ID : 7542800
Protein sequence
Length : 99 residues
>P44437|HFQ_HAEIN Haemophilus influenzae Rd KW20
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTAPTEAVENVETQAE