HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44428

Names and origin
Entry : P44428 (reviewed)
Entry name : FER_HAEIN
Protein names : 2Fe-2S ferredoxin
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : fdx
ORF names : HI_0372
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding; oxidation-reduction process
GO identifier : GO:0051537; GO:0009055; GO:0046872; GO:0055114
Keywords
Ligand & Biological process : 2Fe-2S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Reference proteome; Transport
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Sequence similarities : Belongs to Adrenodoxin/putidaredoxin family
Reference
PubMed ID : 7542800
Protein sequence
Length : 121 residues
>P44428|FER_HAEIN Haemophilus influenzae Rd KW20
MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFD
SLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYNLNHANEAAH