HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44424

Names and origin
Entry : P44424 (reviewed)
Entry name : KDGL_HAEIN
Protein names : Diacylglycerol kinase (DAGK) (EC 2.7.1.107) (Diglyceride kinase) (DGK)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : dgkA
ORF names : HI_0335
EC number : 2.7.1.107
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; diacylglycerol kinase activity; integral to membrane; phospholipid biosynthetic process; plasma membrane
GO identifier : GO:0005524; GO:0004143; GO:0016021; GO:0008654; GO:0005886
Keywords
Ligand & Biological process : ATP-binding; Cell inner membrane; Cell membrane; Complete proteome; Kinase; Lipid biosynthesis; Lipid metabolism; Membrane; Nucleotide-binding; Phospholipid biosynthesis; Phospholipid metabolism; Reference proteome; Transferase; Transmembrane; Transmembra
General annotation
Sequence similarities : Belongs to Bacterial diacylglycerol kinase family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 126 residues
>P44424|KDGL_HAEIN Haemophilus influenzae Rd KW20
MYKTTGLTHLINSTKYSLQGLKSAFKNETAFRHECFLACILIPLTFFLGETKIEIILMIS
SVLLVMALELLNSAVETVVDRIGTERHELSGRAKDQGSASVFIALCIVGIVWGGILFF