HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44386

Names and origin
Entry : P44386 (reviewed)
Entry name : RS21_HAEIN
Protein names : 30S ribosomal protein S21
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpsU
ORF names : rps21
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Reference proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein S21P family
Reference
PubMed ID : 7542800; 8316085
Protein sequence
Length : 79 residues
>P44386|RS21_HAEIN Haemophilus influenzae Rd KW20
MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATLAKRHAKRN
ARENARNTRLY