HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44376

Names and origin
Entry : P44376 (reviewed)
Entry name : RS7_HAEIN
Protein names : 30S ribosomal protein S7
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpsG
ORF names : rps7
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; small ribosomal subunit; structural constituent of ribosome; tRNA binding; translation
GO identifier : GO:0019843; GO:0015935; GO:0003735; GO:0000049; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Reference proteome; Ribonucleoprotein; Ribosomal protein; rRNA-binding; tRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S7P family
Reference
PubMed ID : 7542800
Protein sequence
Length : 168 residues
>P44376|RS7_HAEIN Haemophilus influenzae Rd KW20
MPRRRSVEARKILPDPKFGSELLAKFINVIMVDGKKSVAESIVYGALETLAQRTGKEPLE
AFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWIVEAARKRGDKSMALRL
ANELSDASDNKGAAVKKREDVHRMAEANKAFAHYRW