HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44368

Names and origin
Entry : P44368 (reviewed)
Entry name : RL32_HAEIN
Protein names : 50S ribosomal protein L32
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpmF
ORF names : rpl32
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Reference proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L32P family
Reference
PubMed ID : 7542800
Protein sequence
Length : 60 residues
>P44368|RL32_HAEIN Haemophilus influenzae Rd KW20
MAVQQNKKSRSRRDMRRSHDALTTAAVSVDKASGETHLRHHVTADGYYRGRKVINK