HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44364

Names and origin
Entry : P44364 (reviewed)
Entry name : RL28_HAEIN
Protein names : 50S ribosomal protein L28
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpmB
ORF names : rpl28
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Reference proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L28P family
Reference
PubMed ID : 7542800
Protein sequence
Length : 86 residues
>P44364|RL28_HAEIN Haemophilus influenzae Rd KW20
MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID
KKGIDAVLAEIRARGEKI