HIGDB: Haemophilus influenzae Genome Database

Protein search results for - P44360

Names and origin

Entry	:	P44360 (reviewed)
Entry name	:	RL22_HAEIN
Protein names	:	50S ribosomal protein L22
Organism	:	Haemophilus influenzae Rd KW20
Organism ID	:	71421
Gene names	:	rplV
ORF names	:	rpl22

History

Date of creation	:	1995-11-01
Date of modification	:	2013-11-13
Date of sequence modification	:	1995-11-01

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; response to antibiotic; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0046677; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Antibiotic resistance; Complete proteome; RNA-binding; Reference proteome; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Reference

PubMed ID

7542800; 12604536

Protein sequence

Length

118 residues

>P44360|RL22_HAEIN Haemophilus influenzae Rd KW20
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR