HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44350

Names and origin
Entry : P44350 (reviewed)
Entry name : RL10_HAEIN
Protein names : 50S ribosomal protein L10
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rplJ
ORF names : rpl10
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : LSU rRNA binding; ribosome; ribosome biogenesis; structural constituent of ribosome; translation
GO identifier : GO:0070180; GO:0005840; GO:0042254; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Direct protein sequencing; RNA-binding; Reference proteome; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L10P family
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 175 residues
>P44350|RL10_HAEIN Haemophilus influenzae Rd KW20
MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELRKSAREAGVTMRVVRNTLL
RRAVEGTDYECLKDTFVGPTLIAFSNEHPGARARLFKEFAKANDKFEIKGAAFEGKIQDV
EFLATLPTYEEAIARLMGTMKEAAAGKLARTFAALRDKLQEAA