HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44345

Names and origin
Entry : P44345 (reviewed)
Entry name : RL4_HAEIN
Protein names : 50S ribosomal protein L4
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rplD
ORF names : rpl4
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA-dependent transcription, termination; rRNA binding; regulation of transcription, DNA-dependent; regulation of translation; response to antibiotic; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0006353; GO:0019843; GO:0006355; GO:0006417; GO:0046677; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Antibiotic resistance; Complete proteome; RNA-binding; Reference proteome; Repressor; Ribonucleoprotein; Ribosomal protein; Transcription; Transcription regulation; Transcription termination; Translation regulation; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L4P family
Reference
PubMed ID : 7542800; 8722027; 10498727; 12604536
Protein sequence
Length : 216 residues
>P44345|RL4_HAEIN Haemophilus influenzae Rd KW20
MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGTRAQKTRAEVSGSGKKPWR
QKGTGRARAGDIKSPIWRSGGTTFAAKPQDHSQKVNKKMYRGAIKSILSELVRQDRLVVV
EKFELDAPKTKVLVQKLKDLAVEDALIITASLDENLFLAARNLYKVDVRDVQGIDPVSLI
AFDKVIVTVDAVKQIEEILA