HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44322

Names and origin
Entry : P44322 (reviewed)
Entry name : IF1_HAEIN
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : infA
ORF names : HI_0548
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis; Reference proteome
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 80 residues
>P44322|IF1_HAEIN Haemophilus influenzae Rd KW20
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR