HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44256

Names and origin
Entry : P44256 (reviewed)
Entry name : Y1564_HAEIN
Protein names : Uncharacterized protein HI_1564
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1564
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1998-12-15
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA repair; DNA-directed DNA polymerase activity; damaged DNA binding
GO identifier : GO:0006281; GO:0003887; GO:0003684
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
Reference
PubMed ID : 7542800;
Protein sequence
Length : 54 residues
>P44256|Y1564_HAEIN Haemophilus influenzae Rd KW20
MEKTGLPLSLESFQQLLPQIFMRAKGRSIRLIGLHVNLPEENKQEQMSLW