HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44213

Names and origin
Entry : P44213 (reviewed)
Entry name : Y1486_HAEIN
Protein names : Putative uncharacterized protein HI_1486 in Mu-like prophage FluMu region
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1486
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Uncertain
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
Reference
PubMed ID : 7542800
Protein sequence
Length : 61 residues
>P44213|Y1486_HAEIN Haemophilus influenzae Rd KW20
MMTETRKNELENQLNQMIVMLKEAQKSLFKGQYTHAAIFVGNVSDQLPNMRMMLARG