HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44211

Names and origin
Entry : P44211 (reviewed)
Entry name : Y1484_HAEIN
Protein names : Putative uncharacterized protein HI_1484 in Mu-like prophage FluMu region
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1484
History
Date of creation : 1995-11-01
Date of modification : 2013-05-01
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Uncertain
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
Reference
PubMed ID : 7542800
Protein sequence
Length : 57 residues
>P44211|Y1484_HAEIN Haemophilus influenzae Rd KW20
MMDDLQDVSRLREAYQFYQKAKQDEDSIVCGCLNDAYEWLFSELKALFDEEEE