HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44164

Names and origin
Entry : P44164 (reviewed)
Entry name : SIXA_HAEIN
Protein names : Phosphohistidine phosphatase SixA homolog (EC 3.1.3.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : sixA-A
ORF names : HI_1338;
EC number : 3.1.3.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cellular protein modification process; cytoplasm; phosphohistidine phosphatase activity; phosphoprotein phosphatase activity
GO identifier : GO:0006464; GO:0005737; GO:0008969; GO:0004721
Keywords
Ligand & Biological process : Complete proteome; Hydrolase; Protein phosphatase; Reference proteome
General annotation
Sequence similarities : Belongs to SixA phosphatase family
Reference
PubMed ID : 7542800
Protein sequence
Length : 176 residues
>P44164|SIXA_HAEIN Haemophilus influenzae Rd KW20
MNIFIMRHGEAEVMANSDKARHLTVYGSKQAFLQGQWLKQHLSTLVINSLDRILVSPYVR
AQETFHQVNQAFDLELENKFEIWEGITPYGHAHSVIDYLEVLKDEGVKSVLIVSHLPLVG
EIVAELYGKRNPISFYPATIAQLLWDGNKSEILMHQASPVIYLK