HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44115

Names and origin
Entry : P44115 (reviewed)
Entry name : Y1128_HAEIN
Protein names : Uncharacterized protein HI_1128
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1128
History
Date of creation : 1995-11-01
Date of modification : 2013-05-01
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : integral to membrane
GO identifier : GO:0016021
Keywords
Ligand & Biological process : Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Subcellular location : Membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 62 residues
>P44115|Y1128_HAEIN Haemophilus influenzae Rd KW20
MVYHNSMCTYLFYNKIGFGLDYQLSVYLGLATTIVCIVLFFTMLKPLGTRDEEAYINN