HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44062

Names and origin
Entry : P44062 (reviewed)
Entry name : ZAPA_HAEIN
Protein names : Cell division protein ZapA (Z ring-associated protein ZapA)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : zapA
ORF names : HI_0857
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytoplasm
GO identifier : GO:0000917; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Reference proteome; Septation
General annotation
Sequence similarities : Belongs to ZapA family, Type 1 subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 108 residues
>P44062|ZAPA_HAEIN Haemophilus influenzae Rd KW20
MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKTGLIQLDRVLSIVALN
LSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPH