HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44057

Names and origin
Entry : P44057 (reviewed)
Entry name : BAME_HAEIN
Protein names : Outer membrane protein assembly factor BamE
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : bamE
ORF names : smpA
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2000-05-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell outer membrane assembly; cell outer membrane; protein insertion into membrane
GO identifier : GO:0043165; GO:0009279; GO:0051205
Keywords
Ligand & Biological process : Cell outer membrane; Complete proteome; Lipoprotein; Membrane; Palmitate; Reference proteome; Signal
General annotation
Sequence similarities : Belongs to BamE family
Subcellular location : Cell outer membrane; Lipid-anchor.
Reference
PubMed ID : 7542800
Protein sequence
Length : 149 residues
>P44057|BAME_HAEIN Haemophilus influenzae Rd KW20
MQVKTLLGATFLALSLASCSTVEKVVYRIDVPQGNYLEATTVAQVKEGMTAQQVQYLLGT
PVLVDPYNSQTWYYVFLQQRAYETPVQHTFTVKFDQRGIVTETHLDKPLPQVSQQGENNT
IIETGEKPKSSWWKFWK