HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44048

Names and origin
Entry : P44048 (reviewed)
Entry name : FETP_HAEIN
Protein names : Probable Fe(2+)-trafficking protein
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0760
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : iron ion binding
GO identifier : GO:0005506
Keywords
Ligand & Biological process : Complete proteome; Iron; Reference proteome
General annotation
Sequence similarities : Belongs to Fe(2+)-trafficking protein family
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 98 residues
>P44048|FETP_HAEIN Haemophilus influenzae Rd KW20
MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQTMLVNEKKLNMMNA
EHRKLLEQEMVNFLFEGKDVHIEGYVPPSN