HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44035

Names and origin
Entry : P44035 (reviewed)
Entry name : FTSB_HAEIN
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ftsB
ORF names : HI_0673
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell division site; cytokinesis by binary fission; integral to plasma membrane
GO identifier : GO:0032153; GO:0043093; GO:0005887
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 100 residues
>P44035|FTSB_HAEIN Haemophilus influenzae Rd KW20
MRLLILILLSVLVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGL
TKGFEAIEERARMQHGLVKENEVFYHIVKESK