HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43979

Names and origin
Entry : P43979 (reviewed)
Entry name : Y291_HAEIN
Protein names : Uncharacterized protein HI_0291
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0291
History
Date of creation : 1995-11-01
Date of modification : 2013-12-11
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; Reference proteome
General annotation
Domains : HMA domain (1)
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 76 residues
>P43979|Y291_HAEIN Haemophilus influenzae Rd KW20
MKTITLNIKGIHCGCCVKNLTQVLTELDGVQSADVQLEGKANITFDENRVNVAQLIEVIE
DAGFDATE