HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43977

Names and origin
Entry : P43977 (reviewed)
Entry name : Y279_HAEIN
Protein names : Uncharacterized protein HI_0279
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0279
History
Date of creation : 1995-11-01
Date of modification : 2013-10-16
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : catalytic activity; metabolic process; molybdenum ion binding; pyridoxal phosphate binding
GO identifier : GO:0003824; GO:0008152; GO:0030151; GO:0030170
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
General annotation
Domains : MOSC domain (1)
Reference
PubMed ID : 7542800
Protein sequence
Length : 106 residues
>P43977|Y279_HAEIN Haemophilus influenzae Rd KW20
MNAKILVIKVGQVETLTFSDGSQYESAIRKKVVPSVKIHSLGAEGNDVGLKKHHGGVDKA
LFFMSADSFNELNALLNKDFSLYGYCDIRRKFCRVRLE