HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43939

Names and origin
Entry : P43939 (reviewed)
Entry name : Y094_HAEIN
Protein names : Uncharacterized protein HI_0094
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0094
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : gluconate transmembrane transporter activity; integral to membrane
GO identifier : GO:0015128; GO:0016021
Keywords
Ligand & Biological process : Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Subcellular location : Membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 114 residues
>P43939|Y094_HAEIN Haemophilus influenzae Rd KW20
MSELLINDYTRKGFVDGLCLRLPTICIRPGKPNKATSSFVSSIIREPLHGETSICPVAEK
MAFSFIKFLGKKKEEWALAITGYVVSIPIVLPILIIFIKAILDLGK