HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43921

Names and origin
Entry : P43921 (reviewed)
Entry name : PTHP_HAEIN
Protein names : Phosphocarrier protein HPr (EC 2.7.11.-) (Histidine-containing protein)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ptsH
ORF names : HI_1713
EC number : 2.7.11.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; phosphoenolpyruvate-dependent sugar phosphotransferase system; protein serine/threonine kinase activity; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0009401; GO:0004674; GO:0005351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Kinase; Phosphotransferase system; Reference proteome; Serine/threonine-protein kinase; Sugar transport; Transferase; Transport
General annotation
Domains : HPr domain (1)
Sequence similarities : Belongs to HPr family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 93 residues
>P43921|PTHP_HAEIN Haemophilus influenzae Rd KW20
MYSKDVEIIASNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLALTQGTI
LTISADGEDEQQAVEHLVALIPTLE