HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43874

Names and origin
Entry : P43874 (reviewed)
Entry name : BCCP_HAEIN
Protein names : Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : accB
ORF names : fabE
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : acetyl-CoA carboxylase activity; acetyl-CoA carboxylase complex; fatty acid biosynthetic process
GO identifier : GO:0003989; GO:0009317; GO:0006633
Keywords
Ligand & Biological process : Biotin; Complete proteome; Direct protein sequencing; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Reference proteome
General annotation
Domains : Biotinyl-binding domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 167 residues
>P43874|BCCP_HAEIN Haemophilus influenzae Rd KW20
MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPVIAPAAVQYAAAPVVAPTPAAAP
AQVPAAATTAPAASDELSGHLVRSPMVGTFYRSPSPEAKAFVEVGQSVKVGDALCIVEAM
KMMNRIEADKAGVVKAILINDGNAVEFDEPLIVIE