HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43805

Names and origin
Entry : P43805 (reviewed)
Entry name : SECE_HAEIN
Protein names : Protein translocase subunit SecE
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : secE
ORF names : HI_0716
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; intracellular protein transmembrane transport; plasma membrane; protein secretion; protein targeting; protein transport by the Sec complex
GO identifier : GO:0015450; GO:0016021; GO:0065002; GO:0005886; GO:0009306; GO:0006605; GO:0043952
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Reference proteome; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to SecE/SEC61-gamma family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 114 residues
>P43805|SECE_HAEIN Haemophilus influenzae Rd KW20
MIFFAAAAIGNIYFQQIYSLPIRVIGMAIALVIAFILAAITNQGTKARAFFNDSRTEARK
VVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDLRF