HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43795

Names and origin
Entry : P43795 (reviewed)
Entry name : GLNB_HAEIN
Protein names : Nitrogen regulatory protein P-II
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : glnB
ORF names : HI_0337
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : enzyme regulator activity; nucleotide binding; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0030234; GO:0000166; GO:0050790; GO:0006808; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Nucleotide-binding; Reference proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to P(II) protein family
Reference
PubMed ID : 7542800
Protein sequence
Length : 120 residues
>P43795|GLNB_HAEIN Haemophilus influenzae Rd KW20
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYHVERAIRIRTGEENEDAI