HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43787

Names and origin
Entry : P43787 (reviewed)
Entry name : THIX_HAEIN
Protein names : Thioredoxin-like protein HI_1115
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1115
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : antioxidant activity; cell redox homeostasis; integral to membrane; oxidoreductase activity; plasma membrane
GO identifier : GO:0016209; GO:0045454; GO:0016021; GO:0016491; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Disulfide bond; Membrane; Redox-active center; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to Thioredoxin family
Subcellular location : Cell membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 179 residues
>P43787|THIX_HAEIN Haemophilus influenzae Rd KW20
MKIKKLLKNGLSLFLTFIVITSILDFVRRPVVPEEINKITLQDLQGNTFSLESLDQNKPT
LLYFWGTWCGYCRYTSPAINSLAKEGYQVVSVALRSGNEADVNDYLSKNDYHFTTVNDPK
GEFAERWQINVTPTIVLLSKGKMDLVTTGLTSYWGLKVRLFFAEFFG