HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43785

Names and origin
Entry : P43785 (reviewed)
Entry name : THIO_HAEIN
Protein names : Thioredoxin (Trx)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : trxA
ORF names : trxM
History
Date of creation : 1995-11-01
Date of modification : 2013-12-11
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; glycerol ether metabolic process; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0006662; GO:0015035
Keywords
Ligand & Biological process : Complete proteome; Disulfide bond; Electron transport; Redox-active center; Reference proteome; Transport
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to Thioredoxin family
Reference
PubMed ID : 7542800
Protein sequence
Length : 115 residues
>P43785|THIO_HAEIN Haemophilus influenzae Rd KW20
MSEVLHINDADFESVVVNSDIPILLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV
DDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALPKTQLANFINQHI