HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43780

Names and origin
Entry : P43780 (reviewed)
Entry name : BOLA_HAEIN
Protein names : Protein BolA homolog
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : bolA
ORF names : HI_0163
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Activator; Complete proteome; DNA-binding; Reference proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to BolA/yrbA family
Reference
PubMed ID : 7542800
Protein sequence
Length : 111 residues
>P43780|BOLA_HAEIN Haemophilus influenzae Rd KW20
MSIQQIIEQKIQKEFQPHFLAIENESHLHHSNRGSESHFKCVIVSADFKNIRKVQRHQRI
YQLLNEELNHSIHALALHLFTPEEWKAQNETVPHSTKCAGIGR