HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43758

Names and origin
Entry : P43758 (reviewed)
Entry name : DKSA_HAEIN
Protein names : RNA polymerase-binding transcription factor DksA
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : dksA
ORF names : dsh-1
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; regulation of gene expression; zinc ion binding
GO identifier : GO:0005737; GO:0010468; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Metal-binding; Reference proteome; Zinc; Zinc-finger
General annotation
Domains : DksA C4-type zinc finger (1)
Sequence similarities : Belongs to DksA family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 8063112
Protein sequence
Length : 157 residues
>P43758|DKSA_HAEIN Haemophilus influenzae Rd KW20
MSRASLSLLDLAGVKPYQMKKDEEYMNEEQILHFRKILNAWHEQIVEEASRTVAHMQDEV
TNFPDPADRATQEEEFSLELRNRDRERKLMKKIEATLKKLDTDDFGYCDCCGEEIGIRRL
EARPTADLCIDCKTLAEIREKQVAG