HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43734

Names and origin
Entry : P43734 (reviewed)
Entry name : CH10_HAEIN
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : groS
ORF names : groES
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; protein folding; response to stress
GO identifier : GO:0005524; GO:0005737; GO:0006457; GO:0006950
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm; Reference proteome; Stress response
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 104 residues
>P43734|CH10_HAEIN Haemophilus influenzae Rd KW20
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDIVIFNDGYGVKSEKIDGEEVLIISENDILAIVE