HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43723

Names and origin
Entry : P43723 (reviewed)
Entry name : IHFA_HAEIN
Protein names : Integration host factor subunit alpha (IHF-alpha)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ihfA
ORF names : himA
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Reference proteome; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 7542800
Protein sequence
Length : 104 residues
>P43723|IHFA_HAEIN Haemophilus influenzae Rd KW20
MATITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSS
RPGRNPKTGDVVPVSARRVVTFKPGQKLRARVEKTK