HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43722

Names and origin
Entry : P43722 (reviewed)
Entry name : DBH_HAEIN
Protein names : DNA-binding protein HU
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : hup
ORF names : hupA
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; chromosome condensation
GO identifier : GO:0003677; GO:0030261
Keywords
Ligand & Biological process : Complete proteome; DNA condensation; DNA-binding; Reference proteome
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 7542800
Protein sequence
Length : 98 residues
>P43722|DBH_HAEIN Haemophilus influenzae Rd KW20
MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKEGEPVQLIGFGTFKVNERAARTG
RNPQTGAEIQIAASKVPAFVSGKALKDAIK